PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00405.2.p
Common NameEUGRSUZ_K00405, LOC104424530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 282aa    MW: 30033.2 Da    PI: 8.9901
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00405.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-393191262
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                      k++al+cprC s+ntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+ s
  Eucgr.K00405.2.p 31 KDQALNCPRCSSSNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRPS 91
                      6899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-252683IPR003851Zinc finger, Dof-type
PfamPF027011.2E-333289IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0593589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MEIASSPRPV SVSLQEIKPT CGTTTTSRPH KDQALNCPRC SSSNTKFCYY NNYSLSQPRY  60
FCKTCRRYWT EGGSLRNVPV GGGSRKNKRP SSSFSSSPSS KIIKLPDLVV GPSSLPQNPK  120
THEAQRDLNL TYPPDTTPTT DQQNPKSSSG IIASSSMGLS LSSFMPHMPV ASDSSSNFYA  180
AGGLNFQHLL GLKPTTSSFG SFSGHGFESG GFLGSLQGLQ ESGNGDDSND GAKLFFPVED  240
GLKHQVTSTP RVDGQFGLQS RGQGDHSNGY WNGVLGTGGS W*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00405.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4497266e-41HQ449726.1 Sonneratia caseolaris microsatellite Sc_SSR_17 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035292.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLA0A058ZYQ70.0A0A058ZYQ7_EUCGR; Uncharacterized protein
TrEMBLA0A058ZZS60.0A0A058ZZS6_EUCGR; Uncharacterized protein
STRINGVIT_16s0098g01420.t012e-61(Vitis vinifera)
STRINGGLYMA04G41170.12e-61(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.13e-32Dof family protein